Lineage for d3us8b_ (3us8 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2906106Species Sinorhizobium meliloti [TaxId:266834] [226269] (1 PDB entry)
  8. 2906108Domain d3us8b_: 3us8 B: [217507]
    automated match to d4ja8b_
    complexed with so4

Details for d3us8b_

PDB Entry: 3us8 (more details), 2.25 Å

PDB Description: Crystal Structure of an isocitrate dehydrogenase from Sinorhizobium meliloti 1021
PDB Compounds: (B:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d3us8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3us8b_ c.77.1.1 (B:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
kikvanpvveldgdemtriiwqfikdklihpyldldleyydlgvenrdatddqvtidaan
aikkhgvgvkcatitpdegrveefklkkmwkspngtirnilggvifrepiicknvprlvp
gwtkpiivgrhafgdqyratdfkfpgkgklsikfvgedgqtiehdvydapgagvalamyn
ldesitefarasfnyglqrkvpvylstkntilkaydgrfkdifqkvfdeefaaqfkaekl
wyehrliddmvasalkwsggyvwacknydgdvqsdivaqgfgslglmtsvlmtpdgktve
aeaahgtvtrhyrqhqkgeetstnsiasifawtrglahrakldgnaelakfsetlervcv
dtvesgfmtkdlalligpdqpwlsttgfldkidenlrkama

SCOPe Domain Coordinates for d3us8b_:

Click to download the PDB-style file with coordinates for d3us8b_.
(The format of our PDB-style files is described here.)

Timeline for d3us8b_: