![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) ![]() contains additional, fifth helix at the N-terminus |
![]() | Family a.24.10.0: automated matches [227273] (1 protein) not a true family |
![]() | Protein automated matches [227077] (2 species) not a true protein |
![]() | Species Medicago truncatula [TaxId:3880] [226282] (2 PDB entries) |
![]() | Domain d3us6a_: 3us6 A: [217505] automated match to d2q4fa_ |
PDB Entry: 3us6 (more details), 1.45 Å
SCOPe Domain Sequences for d3us6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3us6a_ a.24.10.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]} evgqmrrqwvdyiksmfmegfldgqflqlqqlqdennpefvfevvslffddserilkdls favdqqsidfkkvdahvhqfkgssasigaqrvknscvafrnfceeqnidacrrclqqvkq eyllvknkletllrleqqivaaggsipm
Timeline for d3us6a_: