Lineage for d3us6a_ (3us6 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1727035Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 1727096Family a.24.10.0: automated matches [227273] (1 protein)
    not a true family
  6. 1727097Protein automated matches [227077] (2 species)
    not a true protein
  7. 1727098Species Medicago truncatula [TaxId:3880] [226282] (2 PDB entries)
  8. 1727100Domain d3us6a_: 3us6 A: [217505]
    automated match to d2q4fa_

Details for d3us6a_

PDB Entry: 3us6 (more details), 1.45 Å

PDB Description: crystal structure of histidine-containing phosphotransfer protein mthpt1 from medicago truncatula
PDB Compounds: (A:) Histidine-containing Phosphotransfer Protein type 1, MtHPt1

SCOPe Domain Sequences for d3us6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3us6a_ a.24.10.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
evgqmrrqwvdyiksmfmegfldgqflqlqqlqdennpefvfevvslffddserilkdls
favdqqsidfkkvdahvhqfkgssasigaqrvknscvafrnfceeqnidacrrclqqvkq
eyllvknkletllrleqqivaaggsipm

SCOPe Domain Coordinates for d3us6a_:

Click to download the PDB-style file with coordinates for d3us6a_.
(The format of our PDB-style files is described here.)

Timeline for d3us6a_: