Lineage for d3us3a3 (3us3 A:229-353)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876577Family c.47.1.3: Calsequestrin [52855] (1 protein)
    duplication: contains three tandem repeats of this fold
  6. 2876578Protein Calsequestrin [52856] (1 species)
  7. 2876579Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52857] (3 PDB entries)
  8. 2876582Domain d3us3a3: 3us3 A:229-353 [217504]
    automated match to d1a8ya3
    complexed with ca, mpd, mrd, na

Details for d3us3a3

PDB Entry: 3us3 (more details), 1.74 Å

PDB Description: Recombinant rabbit skeletal calsequestrin-MPD complex
PDB Compounds: (A:) Calsequestrin-1

SCOPe Domain Sequences for d3us3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3us3a3 c.47.1.3 (A:229-353) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tlrklkpesmyetweddmdgihivafaeeadpdgyefleilksvaqdntdnpdlsiiwid
pddfpllvpywektfdidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvle
geint

SCOPe Domain Coordinates for d3us3a3:

Click to download the PDB-style file with coordinates for d3us3a3.
(The format of our PDB-style files is described here.)

Timeline for d3us3a3: