Lineage for d1e0ob2 (1e0o B:251-360)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518665Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1518734Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 1518748Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (10 PDB entries)
  8. 1518787Domain d1e0ob2: 1e0o B:251-360 [21749]
    Other proteins in same PDB: d1e0oa_, d1e0oc_
    complexed with ni, so4

Details for d1e0ob2

PDB Entry: 1e0o (more details), 2.8 Å

PDB Description: crystal structure of a ternary fgf1-fgfr2-heparin complex
PDB Compounds: (B:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d1e0ob2:

Sequence, based on SEQRES records: (download)

>d1e0ob2 b.1.1.4 (B:251-360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvl

Sequence, based on observed residues (ATOM records): (download)

>d1e0ob2 b.1.1.4 (B:251-360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhlkvlkaagvnttdkeie
vlyirnvtfedageytclagnsigisfhsawltvl

SCOPe Domain Coordinates for d1e0ob2:

Click to download the PDB-style file with coordinates for d1e0ob2.
(The format of our PDB-style files is described here.)

Timeline for d1e0ob2: