Lineage for d1e0ob1 (1e0o B:149-250)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753637Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 2753651Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)
  8. 2753691Domain d1e0ob1: 1e0o B:149-250 [21748]
    Other proteins in same PDB: d1e0oa_, d1e0oc_
    complexed with ni, so4

Details for d1e0ob1

PDB Entry: 1e0o (more details), 2.8 Å

PDB Description: crystal structure of a ternary fgf1-fgfr2-heparin complex
PDB Compounds: (B:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d1e0ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ob1 b.1.1.4 (B:149-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

SCOPe Domain Coordinates for d1e0ob1:

Click to download the PDB-style file with coordinates for d1e0ob1.
(The format of our PDB-style files is described here.)

Timeline for d1e0ob1: