Lineage for d3uprc1 (3upr C:2-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2182926Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries)
  8. 2182942Domain d3uprc1: 3upr C:2-181 [217479]
    Other proteins in same PDB: d3upra2, d3uprb_, d3uprc2, d3uprd_
    automated match to d1a1oa2
    complexed with 1kx, cl

Details for d3uprc1

PDB Entry: 3upr (more details), 2 Å

PDB Description: HLA-B*57:01 complexed to pep-V and Abacavir
PDB Compounds: (C:) hla class I histocompatibility antigen, b-57 alpha chain

SCOPe Domain Sequences for d3uprc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uprc1 d.19.1.1 (C:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
shsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeywd
getrnmkasaqtyrenlrialryynqseagshiiqvmygcdvgpdgrllrghdqsaydgk
dyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlqr

SCOPe Domain Coordinates for d3uprc1:

Click to download the PDB-style file with coordinates for d3uprc1.
(The format of our PDB-style files is described here.)

Timeline for d3uprc1: