SCOPe 2.04: Domain d3uprc1: 3upr C:2-181

Lineage for d3uprc1 (3upr C:2-181)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries)

8. Domain d3uprc1: 3upr C:2-181 [217479]
   Other proteins in same PDB: d3upra2, d3uprb_, d3uprc2, d3uprd_
   automated match to d1a1oa2
   complexed with 1kx, cl

Details for d3uprc1

PDB Entry: 3upr, 2 Å

PDB Description: HLA-B*57:01 complexed to pep-V and Abacavir

PDB Compounds: (C:) hla class I histocompatibility antigen, b-57 alpha chain

SCOPe Domain Sequences for d3uprc1:

Sequence; same for both SEQRES and ATOM records:

>d3uprc1 d.19.1.1 (C:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
shsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeywd
getrnmkasaqtyrenlrialryynqseagshiiqvmygcdvgpdgrllrghdqsaydgk
dyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlqr

Timeline for d3uprc1:

• d3uprc1 first appeared in SCOPe 2.03
  
• d3uprc1 appears in SCOPe 2.05
  
• d3uprc1 appears in the current release, SCOPe 2.08