![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries) |
![]() | Domain d3uprc1: 3upr C:2-181 [217479] Other proteins in same PDB: d3upra2, d3uprb_, d3uprc2, d3uprd_ automated match to d1a1oa2 complexed with 1kx, cl |
PDB Entry: 3upr (more details), 2 Å
SCOPe Domain Sequences for d3uprc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uprc1 d.19.1.1 (C:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]} shsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeywd getrnmkasaqtyrenlrialryynqseagshiiqvmygcdvgpdgrllrghdqsaydgk dyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlqr
Timeline for d3uprc1:
![]() Domains from other chains: (mouse over for more information) d3upra1, d3upra2, d3uprb_, d3uprd_ |