Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries) |
Domain d3upra1: 3upr A:2-181 [217476] Other proteins in same PDB: d3upra2, d3uprb_, d3uprc2, d3uprd_ automated match to d1a1oa2 complexed with 1kx, cl |
PDB Entry: 3upr (more details), 2 Å
SCOPe Domain Sequences for d3upra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3upra1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]} shsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeywd getrnmkasaqtyrenlrialryynqseagshiiqvmygcdvgpdgrllrghdqsaydgk dyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlqr
Timeline for d3upra1:
View in 3D Domains from other chains: (mouse over for more information) d3uprb_, d3uprc1, d3uprc2, d3uprd_ |