Lineage for d3upbb_ (3upb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086659Species Francisella tularensis [TaxId:119856] [196145] (6 PDB entries)
  8. 2086663Domain d3upbb_: 3upb B: [217470]
    automated match to d3igxb_
    complexed with a5p, p6g, peg, pge

Details for d3upbb_

PDB Entry: 3upb (more details), 1.5 Å

PDB Description: 1.5 angstrom resolution crystal structure of transaldolase from francisella tularensis in covalent complex with arabinose-5-phosphate
PDB Compounds: (B:) Transaldolase

SCOPe Domain Sequences for d3upbb_:

Sequence, based on SEQRES records: (download)

>d3upbb_ c.1.10.0 (B:) automated matches {Francisella tularensis [TaxId: 119856]}
ksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskvka
nnpdlnsddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriiary
esngipkdrvlikiaatwegikaakllqkegincnltlifdkaqakacaeagvylvspfv
gritdwqmqqnnlktfpaiadddgvnsvkaiyklykshgfktivmgasfrnveqvialag
cdaltispvlleelknrdehlevkltknddvvtqspqiseadfrwlmnenamathklaeg
irlftkdtieleniikqnl

Sequence, based on observed residues (ATOM records): (download)

>d3upbb_ c.1.10.0 (B:) automated matches {Francisella tularensis [TaxId: 119856]}
ksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskvka
nnpdlnsddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriiary
esngipkdrvlikiaatwegikaakllqkegincnltlifdkaqakacaeagvylvspfv
gritdwqmqqnnlktfpaiadddgvnsvkaiyklykshgfktivmgasfrnveqvialag
cdaltispvlleelknrdehlevkltqiseadfrwlmnenamathklaegirlftkdtie
leniikqnl

SCOPe Domain Coordinates for d3upbb_:

Click to download the PDB-style file with coordinates for d3upbb_.
(The format of our PDB-style files is described here.)

Timeline for d3upbb_: