Lineage for d1djsa2 (1djs A:251-362)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 290223Family b.1.1.4: I set domains [49159] (29 proteins)
  6. 290262Protein Fibroblast growth factor receptor, FGFR [49179] (3 species)
  7. 290276Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (5 PDB entries)
  8. 290294Domain d1djsa2: 1djs A:251-362 [21747]
    Other proteins in same PDB: d1djsb_

Details for d1djsa2

PDB Entry: 1djs (more details), 2.4 Å

PDB Description: ligand-binding portion of fibroblast growth factor receptor 2 in complex with fgf1

SCOP Domain Sequences for d1djsa2:

Sequence, based on SEQRES records: (download)

>d1djsa2 b.1.1.4 (A:251-362) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlpa

Sequence, based on observed residues (ATOM records): (download)

>d1djsa2 b.1.1.4 (A:251-362) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekpylkvlkaagvntt
dkeievlyirnvtfedageytclagnsigisfhsawltvlpa

SCOP Domain Coordinates for d1djsa2:

Click to download the PDB-style file with coordinates for d1djsa2.
(The format of our PDB-style files is described here.)

Timeline for d1djsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1djsa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1djsb_