SCOP 1.57: Domain d1djsa2: 1djs A:251-362

Lineage for d1djsa2 (1djs A:251-362)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (22 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)

7. Species Human (Homo sapiens), FGFR2 [TaxId:9606] [49181] (5 PDB entries)

8. Domain d1djsa2: 1djs A:251-362 [21747]
   Other proteins in same PDB: d1djsb_

Details for d1djsa2

PDB Entry: 1djs, 2.4 Å

PDB Description: ligand-binding portion of fibroblast growth factor receptor 2 in complex with fgf1

SCOP Domain Sequences for d1djsa2:

Sequence, based on SEQRES records:

>d1djsa2 b.1.1.4 (A:251-362) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlpa

Sequence, based on observed residues (ATOM records):

>d1djsa2 b.1.1.4 (A:251-362) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekpylkvlkaagvntt
dkeievlyirnvtfedageytclagnsigisfhsawltvlpa

Timeline for d1djsa2:

• d1djsa2 first appeared (with stable ids) in SCOP 1.55
  
• d1djsa2 appears in SCOP 1.59
  
• d1djsa2 appears in the current release, SCOPe 2.08