SCOPe 2.05: Domain d3un1d_: 3un1 D:

Lineage for d3un1d_ (3un1 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226212] (3 PDB entries)

8. Domain d3un1d_: 3un1 D: [217458]
   automated match to d2c07a1
   complexed with po4

Details for d3un1d_

PDB Entry: 3un1, 2.45 Å

PDB Description: Crystal structure of an oxidoreductase from Sinorhizobium meliloti 1021

PDB Compounds: (D:) Probable oxidoreductase

SCOPe Domain Sequences for d3un1d_:

Sequence; same for both SEQRES and ATOM records:

>d3un1d_ c.2.1.0 (D:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
rnqqkvvvitgasqgigaglvrayrdrnyrvvatsrsikpsadpdihtvagdiskpetad
rivregierfgridslvnnagvflakpfvemtqedydhnlgvnvagffhitqraaaemlk
qgsghivsittslvdqpmvgmpsalasltkgglnavtrslamefsrsgvrvnavspgvik
tpmhpaethstlaglhpvgrmgeirdvvdavlylehagfitgeilhvdggqnagrw

Timeline for d3un1d_:

• d3un1d_ first appeared in SCOPe 2.03
  
• d3un1d_ appears in SCOPe 2.04
  
• d3un1d_ appears in SCOPe 2.06
  
• d3un1d_ appears in the current release, SCOPe 2.08