Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226212] (3 PDB entries) |
Domain d3un1d_: 3un1 D: [217458] automated match to d2c07a1 complexed with po4 |
PDB Entry: 3un1 (more details), 2.45 Å
SCOPe Domain Sequences for d3un1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3un1d_ c.2.1.0 (D:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]} rnqqkvvvitgasqgigaglvrayrdrnyrvvatsrsikpsadpdihtvagdiskpetad rivregierfgridslvnnagvflakpfvemtqedydhnlgvnvagffhitqraaaemlk qgsghivsittslvdqpmvgmpsalasltkgglnavtrslamefsrsgvrvnavspgvik tpmhpaethstlaglhpvgrmgeirdvvdavlylehagfitgeilhvdggqnagrw
Timeline for d3un1d_: