SCOPe 2.08: Domain d3un1a1: 3un1 A:0-236

Lineage for d3un1a1 (3un1 A:0-236)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226212] (3 PDB entries)

8. Domain d3un1a1: 3un1 A:0-236 [217455]
   Other proteins in same PDB: d3un1a2
   automated match to d2c07a1
   complexed with po4

Details for d3un1a1

PDB Entry: 3un1, 2.45 Å

PDB Description: Crystal structure of an oxidoreductase from Sinorhizobium meliloti 1021

PDB Compounds: (A:) Probable oxidoreductase

SCOPe Domain Sequences for d3un1a1:

Sequence; same for both SEQRES and ATOM records:

>d3un1a1 c.2.1.0 (A:0-236) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
mrnqqkvvvitgasqgigaglvrayrdrnyrvvatsrsikpsadpdihtvagdiskpeta
drivregierfgridslvnnagvflakpfvemtqedydhnlgvnvagffhitqraaaeml
kqgsghivsittslvdqpmvgmpsalasltkgglnavtrslamefsrsgvrvnavspgvi
ktpmhpaethstlaglhpvgrmgeirdvvdavlylehagfitgeilhvdggqnagrw

Timeline for d3un1a1:

• d3un1a1 first appeared in SCOPe 2.03, called d3un1a_
  
• d3un1a1 appears in SCOPe 2.07