Lineage for d3umfa_ (3umf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114009Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [226487] (1 PDB entry)
  8. 2114010Domain d3umfa_: 3umf A: [217446]
    automated match to d3ukda_

Details for d3umfa_

PDB Entry: 3umf (more details), 2.05 Å

PDB Description: Schistosoma mansoni adenylate kinase
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d3umfa_:

Sequence, based on SEQRES records: (download)

>d3umfa_ c.37.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
qklakakvifvlggpgsgkgtqceklvqkfhfnhlssgdllraevqsgspkgkelkamme
rgelvplevvlallkeamiklvdknchflidgypreldqgikfekevcpclcvinfdvse
evmrkrllkraetsnrvddneetivkrfrtfneltkpviehykqqnkvitidasgtvdai
fdkvnhelqkfgvk

Sequence, based on observed residues (ATOM records): (download)

>d3umfa_ c.37.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
qklakakvifvlggpgsgkgtqceklvqkfhfnhlssgdllraevqsgspkgkelkamme
rgelvplevvlallkeamiklvdknchflidgypreldqgikfekevcpclcvinfdvse
evmrkrllkrvddneetivkrfrtfneltkpviehykqqnkvitidasgtvdaifdkvnh
elqkfgvk

SCOPe Domain Coordinates for d3umfa_:

Click to download the PDB-style file with coordinates for d3umfa_.
(The format of our PDB-style files is described here.)

Timeline for d3umfa_: