SCOPe 2.03: Domain d3umaa_: 3uma A:

Lineage for d3umaa_ (3uma A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226257] (1 PDB entry)

8. Domain d3umaa_: 3uma A: [217441]
   automated match to d4f82b_
   complexed with so4

Details for d3umaa_

PDB Entry: 3uma, 2.2 Å

PDB Description: Crystal structure of a hypothetical peroxiredoxin protein frm Sinorhizobium meliloti

PDB Compounds: (A:) Hypothetical peroxiredoxin protein

SCOPe Domain Sequences for d3umaa_:

Sequence; same for both SEQRES and ATOM records:

>d3umaa_ c.47.1.0 (A:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
yfqsmmtiavgdklpnatfkektadgpvevttellfkgkrvvlfavpgaftptcslnhlp
gylenrdailargvddiavvavndlhvmgawathsggmgkihflsdwnaaftkaigmeid
lsagtlgirskrysmlvedgvvkalnieespgqatasgaaamlell

Timeline for d3umaa_:

• d3umaa_ is new in SCOPe 2.03-stable
  
• d3umaa_ appears in SCOPe 2.04
  
• d3umaa_ appears in the current release, SCOPe 2.08, called d3umaa1