Lineage for d3ujsa2 (3ujs A:140-433)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823471Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 1823472Protein Enolase [51606] (9 species)
    Fold of this protein slightly differs from common fold in topology
  7. 1823516Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (9 PDB entries)
    Uniprot P09104
  8. 1823525Domain d3ujsa2: 3ujs A:140-433 [217434]
    Other proteins in same PDB: d3ujsa1, d3ujsb1
    automated match to d1pdza1
    complexed with 0v5, mg, trs, xsp

Details for d3ujsa2

PDB Entry: 3ujs (more details), 1.65 Å

PDB Description: asymmetric complex of human neuron specific enolase-6-pga/pep
PDB Compounds: (A:) Gamma-enolase

SCOPe Domain Sequences for d3ujsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ujsa2 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl

SCOPe Domain Coordinates for d3ujsa2:

Click to download the PDB-style file with coordinates for d3ujsa2.
(The format of our PDB-style files is described here.)

Timeline for d3ujsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ujsa1