SCOP 1.55: Domain d1ev2g2: 1ev2 G:251-363

Lineage for d1ev2g2 (1ev2 G:251-363)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (21 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)

7. Species Human (Homo sapiens), FGFR2 [TaxId:9606] [49181] (3 PDB entries)

8. Domain d1ev2g2: 1ev2 G:251-363 [21743]
   Other proteins in same PDB: d1ev2a_, d1ev2b_, d1ev2c_, d1ev2d_

Details for d1ev2g2

PDB Entry: 1ev2, 2.2 Å

PDB Description: crystal structure of fgf2 in complex with the extracellular ligand binding domain of fgf receptor 2 (fgfr2)

SCOP Domain Sequences for d1ev2g2:

Sequence, based on SEQRES records:

>d1ev2g2 b.1.1.4 (G:251-363) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlpap

Sequence, based on observed residues (ATOM records):

>d1ev2g2 b.1.1.4 (G:251-363) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvylkvlkaagvnttdke
ievlyirnvtfedageytclagnsigisfhsawltvlpap

Timeline for d1ev2g2:

• d1ev2g2 appears in SCOP 1.57
  
• d1ev2g2 appears in the current release, SCOPe 2.08