Lineage for d3ujpb_ (3ujp B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143580Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2143581Protein automated matches [190944] (35 species)
    not a true protein
  7. 2143686Species Synechocystis sp. [TaxId:1148] [226531] (1 PDB entry)
  8. 2143688Domain d3ujpb_: 3ujp B: [217427]
    automated match to d1psza_
    complexed with cac, mn, zn

Details for d3ujpb_

PDB Entry: 3ujp (more details), 2.7 Å

PDB Description: Structure of MntC protein at 2.7A
PDB Compounds: (B:) Mn transporter subunit

SCOPe Domain Sequences for d3ujpb_:

Sequence, based on SEQRES records: (download)

>d3ujpb_ c.92.2.0 (B:) automated matches {Synechocystis sp. [TaxId: 1148]}
ekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlilyngm
nlerwfeqflgnvkdvpsvvltegiepipiadgpytdkpnphawmsprnalvyvenirqa
fveldpdnakyynanaavyseqlkaidrqlgadleqvpanqrflvscegafsylardygm
eeiymwpinaeqqftpkqvqtvieevktnnvptifcestvsdkgqkqvaqatgarfggnl
yvdslsteegpvptfldlleydarvitnglla

Sequence, based on observed residues (ATOM records): (download)

>d3ujpb_ c.92.2.0 (B:) automated matches {Synechocystis sp. [TaxId: 1148]}
ekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlilyngm
nlerwfeqflgnvkdvpsvvltegiepipitdkpnphawmsprnalvyvenirqafveld
pdnakyynanaavyseqlkaidrqlgadleqvpanqrflvscegafsylardygmeeiym
wpinaeqqftpkqvqtvieevktnnvptifcestvsdkgqkqvaqatgarfggnlyvdsl
steegpvptfldlleydarvitnglla

SCOPe Domain Coordinates for d3ujpb_:

Click to download the PDB-style file with coordinates for d3ujpb_.
(The format of our PDB-style files is described here.)

Timeline for d3ujpb_: