Lineage for d3ujfa1 (3ujf A:1-139)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649015Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1649060Protein Enolase [54828] (9 species)
  7. 1649104Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (9 PDB entries)
    Uniprot P09104
  8. 1649121Domain d3ujfa1: 3ujf A:1-139 [217422]
    Other proteins in same PDB: d3ujfa2, d3ujfb2
    automated match to d1pdza2
    complexed with 2pg, mg, pep

Details for d3ujfa1

PDB Entry: 3ujf (more details), 2.1 Å

PDB Description: asymmetric complex of human neuron specific enolase-4-pga/pep
PDB Compounds: (A:) Gamma-enolase

SCOPe Domain Sequences for d3ujfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ujfa1 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d3ujfa1:

Click to download the PDB-style file with coordinates for d3ujfa1.
(The format of our PDB-style files is described here.)

Timeline for d3ujfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ujfa2