SCOPe 2.03: Domain d3ujeb1: 3uje B:1-139

Lineage for d3ujeb1 (3uje B:1-139)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (9 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (9 PDB entries)
   Uniprot P09104

8. Domain d3ujeb1: 3uje B:1-139 [217420]
   Other proteins in same PDB: d3ujea2, d3ujeb2
   automated match to d1pdza2
   complexed with 2pg, mg, pep, trs

Details for d3ujeb1

PDB Entry: 3uje, 1.55 Å

PDB Description: asymmetric complex of human neuron specific enolase-3-pga/pep

PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d3ujeb1:

Sequence; same for both SEQRES and ATOM records:

>d3ujeb1 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

Timeline for d3ujeb1:

• d3ujeb1 is new in SCOPe 2.03-stable
  
• d3ujeb1 appears in SCOPe 2.04
  
• d3ujeb1 appears in the current release, SCOPe 2.08