![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (94 species) not a true protein |
![]() | Species Anaerostipes caccae [TaxId:411490] [226255] (1 PDB entry) |
![]() | Domain d3uj2h1: 3uj2 H:2-139 [217416] Other proteins in same PDB: d3uj2a2, d3uj2b2, d3uj2c2, d3uj2d2, d3uj2e2, d3uj2f2, d3uj2g2, d3uj2h2 automated match to d1iyxa2 complexed with mg, so4 |
PDB Entry: 3uj2 (more details), 2 Å
SCOPe Domain Sequences for d3uj2h1:
Sequence, based on SEQRES records: (download)
>d3uj2h1 d.54.1.0 (H:2-139) automated matches {Anaerostipes caccae [TaxId: 411490]} nyleiekvigreiidsrgnptveaevylaggvtgrgtapsgastgefealelrdgdkgrf ggkgvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiaca kaaaaalgvplyrflggl
>d3uj2h1 d.54.1.0 (H:2-139) automated matches {Anaerostipes caccae [TaxId: 411490]} nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa aaalgvplyrflggl
Timeline for d3uj2h1: