Lineage for d3uj2h1 (3uj2 H:2-139)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413014Species Anaerostipes caccae [TaxId:411490] [226255] (1 PDB entry)
  8. 1413022Domain d3uj2h1: 3uj2 H:2-139 [217416]
    Other proteins in same PDB: d3uj2a2, d3uj2b2, d3uj2c2, d3uj2d2, d3uj2e2, d3uj2f2, d3uj2g2, d3uj2h2
    automated match to d1iyxa2
    complexed with mg, so4

Details for d3uj2h1

PDB Entry: 3uj2 (more details), 2 Å

PDB Description: crystal structure of an enolase from anaerostipes caccae (efi target efi-502054) with bound mg and sulfate
PDB Compounds: (H:) enolase 1

SCOPe Domain Sequences for d3uj2h1:

Sequence, based on SEQRES records: (download)

>d3uj2h1 d.54.1.0 (H:2-139) automated matches {Anaerostipes caccae [TaxId: 411490]}
nyleiekvigreiidsrgnptveaevylaggvtgrgtapsgastgefealelrdgdkgrf
ggkgvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiaca
kaaaaalgvplyrflggl

Sequence, based on observed residues (ATOM records): (download)

>d3uj2h1 d.54.1.0 (H:2-139) automated matches {Anaerostipes caccae [TaxId: 411490]}
nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk
gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa
aaalgvplyrflggl

SCOPe Domain Coordinates for d3uj2h1:

Click to download the PDB-style file with coordinates for d3uj2h1.
(The format of our PDB-style files is described here.)

Timeline for d3uj2h1: