Lineage for d3uj2g2 (3uj2 G:140-427)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1344084Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1344085Protein automated matches [226923] (45 species)
    not a true protein
  7. 1344100Species Anaerostipes caccae [TaxId:411490] [226256] (1 PDB entry)
  8. 1344107Domain d3uj2g2: 3uj2 G:140-427 [217415]
    Other proteins in same PDB: d3uj2a1, d3uj2b1, d3uj2c1, d3uj2d1, d3uj2e1, d3uj2f1, d3uj2g1, d3uj2h1
    automated match to d1iyxa1
    complexed with mg, so4

Details for d3uj2g2

PDB Entry: 3uj2 (more details), 2 Å

PDB Description: crystal structure of an enolase from anaerostipes caccae (efi target efi-502054) with bound mg and sulfate
PDB Compounds: (G:) enolase 1

SCOPe Domain Sequences for d3uj2g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uj2g2 c.1.11.0 (G:140-427) automated matches {Anaerostipes caccae [TaxId: 411490]}
nanrlpvpmmnilnggahaantvdvqefmimpvgaesfrealrqctevfhalagllkskg
latsvgdeggfapdlasdeeaieyileavklagyepgrdfvlamdaassewkgekkgeyi
lpkckrkfaseelvahwkslcerypivsiedgldeedwegwqymtrelgdkiqlvgddlf
vtnterlnkgikercgnsiliklnqigtvsetleaikmahkagytavvshrsgetedtti
adlavalntgqiktgapsrservakynqllrieeelgdsavypgfttf

SCOPe Domain Coordinates for d3uj2g2:

Click to download the PDB-style file with coordinates for d3uj2g2.
(The format of our PDB-style files is described here.)

Timeline for d3uj2g2: