Lineage for d1ev2f2 (1ev2 F:251-359)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2364958Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 2364972Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)
  8. 2364979Domain d1ev2f2: 1ev2 F:251-359 [21741]
    Other proteins in same PDB: d1ev2a_, d1ev2b_, d1ev2c_, d1ev2d_
    complexed with so4

Details for d1ev2f2

PDB Entry: 1ev2 (more details), 2.2 Å

PDB Description: crystal structure of fgf2 in complex with the extracellular ligand binding domain of fgf receptor 2 (fgfr2)
PDB Compounds: (F:) protein (fibroblast growth factor receptor 2)

SCOPe Domain Sequences for d1ev2f2:

Sequence, based on SEQRES records: (download)

>d1ev2f2 b.1.1.4 (F:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltv

Sequence, based on observed residues (ATOM records): (download)

>d1ev2f2 b.1.1.4 (F:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsphrpilqaglpanastvvgdvefvckvysdaqphiqwikhylkvlkaagvnttdkeie
vlyirnvtfedageytclagnsigisfhsawltv

SCOPe Domain Coordinates for d1ev2f2:

Click to download the PDB-style file with coordinates for d1ev2f2.
(The format of our PDB-style files is described here.)

Timeline for d1ev2f2: