SCOPe 2.05: Domain d3uj2c1: 3uj2 C:2-139

Lineage for d3uj2c1 (3uj2 C:2-139)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Anaerostipes caccae [TaxId:411490] [226255] (1 PDB entry)

8. Domain d3uj2c1: 3uj2 C:2-139 [217406]
   Other proteins in same PDB: d3uj2a2, d3uj2b2, d3uj2c2, d3uj2d2, d3uj2e2, d3uj2f2, d3uj2g2, d3uj2h2
   automated match to d1iyxa2
   complexed with mg, so4

Details for d3uj2c1

PDB Entry: 3uj2, 2 Å

PDB Description: crystal structure of an enolase from anaerostipes caccae (efi target efi-502054) with bound mg and sulfate

PDB Compounds: (C:) enolase 1

SCOPe Domain Sequences for d3uj2c1:

Sequence, based on SEQRES records:

>d3uj2c1 d.54.1.0 (C:2-139) automated matches {Anaerostipes caccae [TaxId: 411490]}
nyleiekvigreiidsrgnptveaevylaggvtgrgtapsgastgefealelrdgdkgrf
ggkgvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiaca
kaaaaalgvplyrflggl

Sequence, based on observed residues (ATOM records):

>d3uj2c1 d.54.1.0 (C:2-139) automated matches {Anaerostipes caccae [TaxId: 411490]}
nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk
gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa
aaalgvplyrflggl

Timeline for d3uj2c1:

• d3uj2c1 first appeared in SCOPe 2.03
  
• d3uj2c1 appears in SCOPe 2.04
  
• d3uj2c1 appears in SCOPe 2.06
  
• d3uj2c1 appears in the current release, SCOPe 2.08