| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (59 species) not a true protein |
| Species Anaerostipes caccae [TaxId:411490] [226256] (1 PDB entry) |
| Domain d3uj2b2: 3uj2 B:140-427 [217405] Other proteins in same PDB: d3uj2a1, d3uj2b1, d3uj2c1, d3uj2d1, d3uj2e1, d3uj2f1, d3uj2g1, d3uj2h1 automated match to d1iyxa1 complexed with mg, so4 |
PDB Entry: 3uj2 (more details), 2 Å
SCOPe Domain Sequences for d3uj2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uj2b2 c.1.11.0 (B:140-427) automated matches {Anaerostipes caccae [TaxId: 411490]}
nanrlpvpmmnilnggahaantvdvqefmimpvgaesfrealrqctevfhalagllkskg
latsvgdeggfapdlasdeeaieyileavklagyepgrdfvlamdaassewkgekkgeyi
lpkckrkfaseelvahwkslcerypivsiedgldeedwegwqymtrelgdkiqlvgddlf
vtnterlnkgikercgnsiliklnqigtvsetleaikmahkagytavvshrsgetedtti
adlavalntgqiktgapsrservakynqllrieeelgdsavypgfttf
Timeline for d3uj2b2: