SCOPe 2.08: Domain d3uj2a2: 3uj2 A:140-427

Lineage for d3uj2a2 (3uj2 A:140-427)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Anaerostipes caccae [TaxId:411490] [226256] (1 PDB entry)

8. Domain d3uj2a2: 3uj2 A:140-427 [217403]
   Other proteins in same PDB: d3uj2a1, d3uj2b1, d3uj2c1, d3uj2d1, d3uj2e1, d3uj2f1, d3uj2g1, d3uj2h1
   automated match to d1iyxa1
   complexed with mg, so4

Details for d3uj2a2

PDB Entry: 3uj2, 2 Å

PDB Description: crystal structure of an enolase from anaerostipes caccae (efi target efi-502054) with bound mg and sulfate

PDB Compounds: (A:) enolase 1

SCOPe Domain Sequences for d3uj2a2:

Sequence; same for both SEQRES and ATOM records:

>d3uj2a2 c.1.11.0 (A:140-427) automated matches {Anaerostipes caccae [TaxId: 411490]}
nanrlpvpmmnilnggahaantvdvqefmimpvgaesfrealrqctevfhalagllkskg
latsvgdeggfapdlasdeeaieyileavklagyepgrdfvlamdaassewkgekkgeyi
lpkckrkfaseelvahwkslcerypivsiedgldeedwegwqymtrelgdkiqlvgddlf
vtnterlnkgikercgnsiliklnqigtvsetleaikmahkagytavvshrsgetedtti
adlavalntgqiktgapsrservakynqllrieeelgdsavypgfttf

Timeline for d3uj2a2:

• d3uj2a2 first appeared in SCOPe 2.03
  
• d3uj2a2 appears in SCOPe 2.07