Lineage for d3uj1a_ (3uj1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879614Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2879845Domain d3uj1a_: 3uj1 A: [217401]
    automated match to d3h79a_

Details for d3uj1a_

PDB Entry: 3uj1 (more details), 2.65 Å

PDB Description: Crystal structure of the third thioredoxin domain of human ERp46
PDB Compounds: (A:) Thioredoxin domain-containing protein 5

SCOPe Domain Sequences for d3uj1a_:

Sequence, based on SEQRES records: (download)

>d3uj1a_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvlaltennfddtiaegitfikfyapwcghcktlaptweelskkefpglagvkiaevdct
aernicskysvrgyptlllfrggkkvsehsggrdldslhrfvlsqa

Sequence, based on observed residues (ATOM records): (download)

>d3uj1a_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvlaltennfddtiaegitfikfyapwcghcktlaptweelskgvkiaevdctaernics
kysvrgyptlllfrggkkvsehsggrdldslhrfvlsqa

SCOPe Domain Coordinates for d3uj1a_:

Click to download the PDB-style file with coordinates for d3uj1a_.
(The format of our PDB-style files is described here.)

Timeline for d3uj1a_: