SCOP 1.73: Domain d1ev2e2: 1ev2 E:251-360

Lineage for d1ev2e2 (1ev2 E:251-360)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.4: I set domains [49159] (36 proteins)
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (6 PDB entries)
Domain d1ev2e2: 1ev2 E:251-360 [21739]
Other proteins in same PDB: d1ev2a_, d1ev2b_, d1ev2c_, d1ev2d_

Details for d1ev2e2

PDB Entry: 1ev2 (more details), 2.2 Å

PDB Description: crystal structure of fgf2 in complex with the extracellular ligand binding domain of fgf receptor 2 (fgfr2)

PDB Compounds: (E:) protein (fibroblast growth factor receptor 2)

SCOP Domain Sequences for d1ev2e2:

Sequence, based on SEQRES records: (download)

>d1ev2e2 b.1.1.4 (E:251-360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvl

Sequence, based on observed residues (ATOM records): (download)

>d1ev2e2 b.1.1.4 (E:251-360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsphrpilqaglpanasdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievl
yirnvtfedageytclagnsigisfhsawltvl

SCOP Domain Coordinates for d1ev2e2:

Click to download the PDB-style file with coordinates for d1ev2e2.
(The format of our PDB-style files is described here.)

Timeline for d1ev2e2: