Lineage for d3uhjd_ (3uhj D:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624884Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 2624885Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 2624954Family e.22.1.0: automated matches [191565] (1 protein)
    not a true family
  6. 2624955Protein automated matches [190982] (12 species)
    not a true protein
  7. 2625011Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226254] (1 PDB entry)
  8. 2625015Domain d3uhjd_: 3uhj D: [217383]
    automated match to d1jqaa_
    complexed with gol, se, zn

Details for d3uhjd_

PDB Entry: 3uhj (more details), 2.34 Å

PDB Description: Crystal structure of a probable glycerol dehydrogenase from Sinorhizobium meliloti 1021
PDB Compounds: (D:) Probable glycerol dehydrogenase

SCOPe Domain Sequences for d3uhjd_:

Sequence, based on SEQRES records: (download)

>d3uhjd_ e.22.1.0 (D:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
arafggpnkyiqrageidklaaylaplgkralvlidrvlfdalserigkscgdsldirfe
rfggecctseiervrkvaiehgsdilvgvgggktadtakivaidtgariviaptiastda
pcsaiavrytehgvyeealrlprnpdavvvdsalvaaaparflvagigdalstwfearsn
iesrtdnyvaggfpateagmaiarhcqdvltrdavkakiaveaglltpaveniieantll
sglgfencgcsaahgihdgltvleevhgyfhgekvafgtlcllmlenrdraeieamirfc
rsvglptkladlgivddvpakigrvaeaacrpgniiyatpvtitvpavrdailaldafsr
sih

Sequence, based on observed residues (ATOM records): (download)

>d3uhjd_ e.22.1.0 (D:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
arafggpnkyiqrageidklaaylaplgkralvlidrvlfdalserisldirferfggec
ctseiervrkvaiehgsdilvgvgggktadtakivaidtgariviaptiastdapcsaia
vrytehgvyeealrlprnpdavvvdsalvaaaparflvagigdalstwfearsniesrtd
nyvaggfpateagmaiarhcqdvltrdavkakiaveaglltpaveniieantllsglgfe
ncgcsaahgihdgltvleevhgyfhgekvafgtlcllmlenrdraeieamirfcrsvglp
tkladlgivddvpakigrvaeaacrpgniiyatpvtitvpavrdailaldafsrsih

SCOPe Domain Coordinates for d3uhjd_:

Click to download the PDB-style file with coordinates for d3uhjd_.
(The format of our PDB-style files is described here.)

Timeline for d3uhjd_: