SCOPe 2.03: Domain d3ugxd1: 3ugx D:9-182

Lineage for d3ugxd1 (3ugx D:9-182)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)

6. Protein automated matches [227018] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225765] (3 PDB entries)

8. Domain d3ugxd1: 3ugx D:9-182 [217378]
   automated match to d1cf1b1
   complexed with edo, imd, k, na, ptd

Details for d3ugxd1

PDB Entry: 3ugx, 2.65 Å

PDB Description: crystal structure of visual arrestin

PDB Compounds: (D:) S-arrestin

SCOPe Domain Sequences for d3ugxd1:

Sequence, based on SEQRES records:

>d3ugxd1 b.1.18.11 (D:9-182) automated matches {Cow (Bos taurus) [TaxId: 9913]}
nhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafryg
qedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdylpc
svmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqhapr

Sequence, based on observed residues (ATOM records):

>d3ugxd1 b.1.18.11 (D:9-182) automated matches {Cow (Bos taurus) [TaxId: 9913]}
nhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafryg
qedidvmglsfrrdlyfsqvqvfppvttrlqeslikklgantypflltfpdylpcsvmlq
papqdvgkscgvdfeikafatdkipkkssvrllirkvqhapr

Timeline for d3ugxd1:

• d3ugxd1 is new in SCOPe 2.03-stable
  
• d3ugxd1 appears in SCOPe 2.04
  
• d3ugxd1 appears in the current release, SCOPe 2.08