Lineage for d3ugxc2 (3ugx C:183-386)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032796Family b.1.18.11: Arrestin/Vps26-like [81291] (2 protein domains)
  6. 2032832Protein automated matches [227018] (1 species)
    not a true protein
  7. 2032833Species Cow (Bos taurus) [TaxId:9913] [225765] (5 PDB entries)
  8. 2032841Domain d3ugxc2: 3ugx C:183-386 [217377]
    automated match to d1cf1b2
    complexed with edo, imd, k, na, ptd

Details for d3ugxc2

PDB Entry: 3ugx (more details), 2.65 Å

PDB Description: crystal structure of visual arrestin
PDB Compounds: (C:) S-arrestin

SCOPe Domain Sequences for d3ugxc2:

Sequence, based on SEQRES records: (download)

>d3ugxc2 b.1.18.11 (C:183-386) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
pdtakesfqdenfvfeefarqnlk

Sequence, based on observed residues (ATOM records): (download)

>d3ugxc2 b.1.18.11 (C:183-386) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllssevatevpfrlmhpqpeddenf
vfeefarqnlk

SCOPe Domain Coordinates for d3ugxc2:

Click to download the PDB-style file with coordinates for d3ugxc2.
(The format of our PDB-style files is described here.)

Timeline for d3ugxc2: