SCOPe 2.08: Domain d3ugxc2: 3ugx C:183-386

Lineage for d3ugxc2 (3ugx C:183-386)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)

6. Protein automated matches [227018] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225765] (5 PDB entries)

8. Domain d3ugxc2: 3ugx C:183-386 [217377]
   automated match to d1cf1b2
   complexed with edo, imd, k, na, ptd

Details for d3ugxc2

PDB Entry: 3ugx, 2.65 Å

PDB Description: crystal structure of visual arrestin

PDB Compounds: (C:) S-arrestin

SCOPe Domain Sequences for d3ugxc2:

Sequence, based on SEQRES records:

>d3ugxc2 b.1.18.11 (C:183-386) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
pdtakesfqdenfvfeefarqnlk

Sequence, based on observed residues (ATOM records):

>d3ugxc2 b.1.18.11 (C:183-386) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllssevatevpfrlmhpqpeddenf
vfeefarqnlk

Timeline for d3ugxc2:

• d3ugxc2 first appeared in SCOPe 2.03
  
• d3ugxc2 appears in SCOPe 2.07