![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins) |
![]() | Protein automated matches [227018] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [225765] (5 PDB entries) |
![]() | Domain d3ugxa1: 3ugx A:9-182 [217372] automated match to d1cf1b1 complexed with edo, imd, k, na, ptd |
PDB Entry: 3ugx (more details), 2.65 Å
SCOPe Domain Sequences for d3ugxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ugxa1 b.1.18.11 (A:9-182) automated matches {Cow (Bos taurus) [TaxId: 9913]} nhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafryg qedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdylpc svmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqhapr
Timeline for d3ugxa1: