SCOP 1.61: Domain d1fq9d2: 1fq9 D:251-359

Lineage for d1fq9d2 (1fq9 D:251-359)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.4: I set domains [49159] (25 proteins)
Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)
Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
Domain d1fq9d2: 1fq9 D:251-359 [21737]
Other proteins in same PDB: d1fq9a_, d1fq9b_

Details for d1fq9d2

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex

SCOP Domain Sequences for d1fq9d2:

Sequence, based on SEQRES records: (download)

>d1fq9d2 b.1.1.4 (D:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqi
lktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvl

Sequence, based on observed residues (ATOM records): (download)

>d1fq9d2 b.1.1.4 (D:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhvqilktagvnttdkemev
lhlrnvsfedageytclagnsiglshhsawltvl

SCOP Domain Coordinates for d1fq9d2:

Click to download the PDB-style file with coordinates for d1fq9d2.
(The format of our PDB-style files is described here.)

Timeline for d1fq9d2: