![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
![]() | Domain d1fq9d2: 1fq9 D:251-359 [21737] Other proteins in same PDB: d1fq9a_, d1fq9b_ |
PDB Entry: 1fq9 (more details), 3 Å
SCOPe Domain Sequences for d1fq9d2:
Sequence, based on SEQRES records: (download)
>d1fq9d2 b.1.1.4 (D:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqi lktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvl
>d1fq9d2 b.1.1.4 (D:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhvqilktagvnttdkemev lhlrnvsfedageytclagnsiglshhsawltvl
Timeline for d1fq9d2:
![]() Domains from other chains: (mouse over for more information) d1fq9a_, d1fq9b_, d1fq9c1, d1fq9c2 |