Lineage for d3ugla1 (3ugl A:231-280)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264294Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 2264295Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 2264296Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 2264319Protein automated matches [193184] (2 species)
    not a true protein
  7. 2264322Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries)
  8. 2264327Domain d3ugla1: 3ugl A:231-280 [217367]
    Other proteins in same PDB: d3ugla2, d3ugla3, d3uglb2, d3uglb3
    automated match to d3ugib_
    complexed with 09v, po4, zn

Details for d3ugla1

PDB Entry: 3ugl (more details), 1.36 Å

PDB Description: structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
PDB Compounds: (A:) Proteine kinase C delta type

SCOPe Domain Sequences for d3ugla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ugla1 g.49.1.1 (A:231-280) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc

SCOPe Domain Coordinates for d3ugla1:

Click to download the PDB-style file with coordinates for d3ugla1.
(The format of our PDB-style files is described here.)

Timeline for d3ugla1: