| Class g: Small proteins [56992] (94 folds) |
| Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) ![]() |
| Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins) Pfam PF00130 |
| Protein automated matches [193184] (2 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries) |
| Domain d3ugla1: 3ugl A:231-280 [217367] Other proteins in same PDB: d3ugla2, d3ugla3, d3uglb2, d3uglb3 automated match to d3ugib_ complexed with 09v, po4, zn |
PDB Entry: 3ugl (more details), 1.36 Å
SCOPe Domain Sequences for d3ugla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ugla1 g.49.1.1 (A:231-280) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc
Timeline for d3ugla1: