SCOPe 2.04: Domain d1fq9d1: 1fq9 D:149-250

Lineage for d1fq9d1 (1fq9 D:149-250)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.4: I set domains [49159] (39 proteins)
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
Domain d1fq9d1: 1fq9 D:149-250 [21736]
Other proteins in same PDB: d1fq9a_, d1fq9b_

Details for d1fq9d1

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex

PDB Compounds: (D:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d1fq9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq9d1 b.1.1.4 (D:149-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvver

SCOPe Domain Coordinates for d1fq9d1:

Click to download the PDB-style file with coordinates for d1fq9d1.
(The format of our PDB-style files is described here.)

Timeline for d1fq9d1: