Lineage for d1fq9d1 (1fq9 D:149-250)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 935313Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 935381Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 935382Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (4 PDB entries)
  8. 935397Domain d1fq9d1: 1fq9 D:149-250 [21736]
    Other proteins in same PDB: d1fq9a_, d1fq9b_

Details for d1fq9d1

PDB Entry: 1fq9 (more details), 3 Å

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex
PDB Compounds: (D:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d1fq9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq9d1 b.1.1.4 (D:149-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvver

SCOPe Domain Coordinates for d1fq9d1:

Click to download the PDB-style file with coordinates for d1fq9d1.
(The format of our PDB-style files is described here.)

Timeline for d1fq9d1: