Lineage for d1fq9d1 (1fq9 D:149-250)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160385Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 160418Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)
  7. 160419Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
  8. 160430Domain d1fq9d1: 1fq9 D:149-250 [21736]
    Other proteins in same PDB: d1fq9a_, d1fq9b_

Details for d1fq9d1

PDB Entry: 1fq9 (more details), 3 Å

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex

SCOP Domain Sequences for d1fq9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq9d1 b.1.1.4 (D:149-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvver

SCOP Domain Coordinates for d1fq9d1:

Click to download the PDB-style file with coordinates for d1fq9d1.
(The format of our PDB-style files is described here.)

Timeline for d1fq9d1: