SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1fq9d1 (1fq9 D:149-250)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026186Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2026255Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
  8. 2026267Domain d1fq9d1: 1fq9 D:149-250 [21736]
    Other proteins in same PDB: d1fq9a_, d1fq9b_

Details for d1fq9d1

PDB Entry: 1fq9 (more details), 3 Å

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex
PDB Compounds: (D:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d1fq9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq9d1 b.1.1.4 (D:149-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvver

SCOPe Domain Coordinates for d1fq9d1:

Click to download the PDB-style file with coordinates for d1fq9d1.
(The format of our PDB-style files is described here.)

Timeline for d1fq9d1: