SCOPe 2.06: Domain d3ufxh1: 3ufx H:1-121

Lineage for d3ufxh1 (3ufx H:1-121)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Thermus aquaticus [TaxId:271] [226411] (1 PDB entry)

8. Domain d3ufxh1: 3ufx H:1-121 [217358]
   Other proteins in same PDB: d3ufxa2, d3ufxd2, d3ufxf2, d3ufxh2
   automated match to d1jkja1
   complexed with gdp, mn

Details for d3ufxh1

PDB Entry: 3ufx, 2.35 Å

PDB Description: thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+

PDB Compounds: (H:) succinyl-CoA synthetase alpha subunit

SCOPe Domain Sequences for d3ufxh1:

Sequence; same for both SEQRES and ATOM records:

>d3ufxh1 c.2.1.0 (H:1-121) automated matches {Thermus aquaticus [TaxId: 271]}
milvnketrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeav
ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
g

Timeline for d3ufxh1:

• d3ufxh1 first appeared in SCOPe 2.03
  
• d3ufxh1 appears in SCOPe 2.05
  
• d3ufxh1 appears in SCOPe 2.07
  
• d3ufxh1 appears in the current release, SCOPe 2.08