Lineage for d3ufxh1 (3ufx H:1-121)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848873Species Thermus aquaticus [TaxId:271] [226411] (1 PDB entry)
  8. 2848877Domain d3ufxh1: 3ufx H:1-121 [217358]
    Other proteins in same PDB: d3ufxa2, d3ufxd2, d3ufxf2, d3ufxh2
    automated match to d1jkja1
    complexed with gdp, mn

Details for d3ufxh1

PDB Entry: 3ufx (more details), 2.35 Å

PDB Description: thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+
PDB Compounds: (H:) succinyl-CoA synthetase alpha subunit

SCOPe Domain Sequences for d3ufxh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ufxh1 c.2.1.0 (H:1-121) automated matches {Thermus aquaticus [TaxId: 271]}
milvnketrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeav
ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
g

SCOPe Domain Coordinates for d3ufxh1:

Click to download the PDB-style file with coordinates for d3ufxh1.
(The format of our PDB-style files is described here.)

Timeline for d3ufxh1: