SCOP 1.59: Domain d1fq9c2: 1fq9 C:251-359

Lineage for d1fq9c2 (1fq9 C:251-359)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.4: I set domains [49159] (25 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)

7. Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)

8. Domain d1fq9c2: 1fq9 C:251-359 [21735]
   Other proteins in same PDB: d1fq9a_, d1fq9b_

Details for d1fq9c2

PDB Entry: 1fq9, 3 Å

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex

SCOP Domain Sequences for d1fq9c2:

Sequence; same for both SEQRES and ATOM records:

>d1fq9c2 b.1.1.4 (C:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqi
lktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvl

Timeline for d1fq9c2:

• d1fq9c2 first appeared (with stable ids) in SCOP 1.55
  
• d1fq9c2 appears in SCOP 1.57
  
• d1fq9c2 appears in SCOP 1.61
  
• d1fq9c2 appears in the current release, SCOPe 2.08