Lineage for d1fq9c2 (1fq9 C:251-359)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753637Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
  8. 2753648Domain d1fq9c2: 1fq9 C:251-359 [21735]
    Other proteins in same PDB: d1fq9a_, d1fq9b_

Details for d1fq9c2

PDB Entry: 1fq9 (more details), 3 Å

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex
PDB Compounds: (C:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d1fq9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq9c2 b.1.1.4 (C:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqi
lktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvl

SCOPe Domain Coordinates for d1fq9c2:

Click to download the PDB-style file with coordinates for d1fq9c2.
(The format of our PDB-style files is described here.)

Timeline for d1fq9c2:

2753648
d1fq9c2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1fq9c1