Lineage for d1fq9c1 (1fq9 C:149-250)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2364958Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
  8. 2364968Domain d1fq9c1: 1fq9 C:149-250 [21734]
    Other proteins in same PDB: d1fq9a_, d1fq9b_

Details for d1fq9c1

PDB Entry: 1fq9 (more details), 3 Å

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex
PDB Compounds: (C:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d1fq9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq9c1 b.1.1.4 (C:149-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvver

SCOPe Domain Coordinates for d1fq9c1:

Click to download the PDB-style file with coordinates for d1fq9c1.
(The format of our PDB-style files is described here.)

Timeline for d1fq9c1:

2364968
d1fq9c1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1fq9c2