SCOP 1.69: Domain d1fq9c1: 1fq9 C:149-250

Lineage for d1fq9c1 (1fq9 C:149-250)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)

8. Domain d1fq9c1: 1fq9 C:149-250 [21734]
   Other proteins in same PDB: d1fq9a_, d1fq9b_

Details for d1fq9c1

PDB Entry: 1fq9, 3 Å

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex

SCOP Domain Sequences for d1fq9c1:

Sequence; same for both SEQRES and ATOM records:

>d1fq9c1 b.1.1.4 (C:149-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvver

Timeline for d1fq9c1:

• d1fq9c1 first appeared (with stable ids) in SCOP 1.55
  
• d1fq9c1 appears in SCOP 1.67
  
• d1fq9c1 appears in SCOP 1.71
  
• d1fq9c1 appears in the current release, SCOPe 2.08