SCOPe 2.07: Domain d3uf4a2: 3uf4 A:147-244

Lineage for d3uf4a2 (3uf4 A:147-244)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries)

8. Domain d3uf4a2: 3uf4 A:147-244 [217331]
   Other proteins in same PDB: d3uf4a1
   automated match to d1fmka2
   complexed with cl, gol, na

Details for d3uf4a2

PDB Entry: 3uf4, 1.98 Å

PDB Description: crystal structure of a sh3 and sh2 domains of fyn protein (proto- concogene tyrosine-protein kinase fyn) from mus musculus at 1.98 a resolution

PDB Compounds: (A:) Tyrosine-protein kinase Fyn, Isoform 2

SCOPe Domain Sequences for d3uf4a2:

Sequence; same for both SEQRES and ATOM records:

>d3uf4a2 d.93.1.0 (A:147-244) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkhykir
kldnggyyittraqfetlqqlvqhysekadglcfnltv

Timeline for d3uf4a2:

• d3uf4a2 first appeared in SCOPe 2.03
  
• d3uf4a2 appears in SCOPe 2.06
  
• d3uf4a2 appears in the current release, SCOPe 2.08