Lineage for d3uf4a2 (3uf4 A:147-244)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1919172Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1919173Protein automated matches [190561] (3 species)
    not a true protein
  7. 1919241Species Mouse (Mus musculus) [TaxId:10090] [226265] (4 PDB entries)
  8. 1919242Domain d3uf4a2: 3uf4 A:147-244 [217331]
    Other proteins in same PDB: d3uf4a1
    automated match to d1fmka2
    complexed with cl, gol, na

Details for d3uf4a2

PDB Entry: 3uf4 (more details), 1.98 Å

PDB Description: crystal structure of a sh3 and sh2 domains of fyn protein (proto- concogene tyrosine-protein kinase fyn) from mus musculus at 1.98 a resolution
PDB Compounds: (A:) Tyrosine-protein kinase Fyn, Isoform 2

SCOPe Domain Sequences for d3uf4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uf4a2 d.93.1.0 (A:147-244) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkhykir
kldnggyyittraqfetlqqlvqhysekadglcfnltv

SCOPe Domain Coordinates for d3uf4a2:

Click to download the PDB-style file with coordinates for d3uf4a2.
(The format of our PDB-style files is described here.)

Timeline for d3uf4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uf4a1