Lineage for d1evtd2 (1evt D:251-359)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54308Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)
  7. 54309Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
  8. 54317Domain d1evtd2: 1evt D:251-359 [21733]
    Other proteins in same PDB: d1evta_, d1evtb_

Details for d1evtd2

PDB Entry: 1evt (more details), 2.8 Å

PDB Description: crystal structure of fgf1 in complex with the extracellular ligand binding domain of fgf receptor 1 (fgfr1)

SCOP Domain Sequences for d1evtd2:

Sequence, based on SEQRES records: (download)

>d1evtd2 b.1.1.4 (D:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqi
lktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvl

Sequence, based on observed residues (ATOM records): (download)

>d1evtd2 b.1.1.4 (D:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
sphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhipyvqilktaevlhlrnv
sfedageytclagnsiglshhsawltvl

SCOP Domain Coordinates for d1evtd2:

Click to download the PDB-style file with coordinates for d1evtd2.
(The format of our PDB-style files is described here.)

Timeline for d1evtd2: